General Information

  • ID:  hor001980
  • Uniprot ID:  P16043
  • Protein name:  Somatoliberin
  • Gene name:  Ghrh
  • Organism:  Mus musculus (Mouse)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  hypothalamus
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0016608 growth hormone-releasing hormone activity; GO:0031770 growth hormone-releasing hormone receptor binding; GO:0051428 peptide hormone receptor binding
  • GO BP:  GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0008284 positive regulation of cell population proliferation; GO:0010667 negative regulation of cardiac muscle cell apoptotic process; GO:0021984 adenohypophysis development; GO:0030252 growth hormone secretion; GO:0032094 response to food; GO:0032879 regulation of localization; GO:0035264 multicellular organism growth; GO:0040018 positive regulation of multicellular organism growth; GO:0043950 positive regulation of cAMP-mediated signaling; GO:0045893 positive regulation of DNA-templated transcription; GO:0046010 positive regulation of circadian sleep/wake cycle, non-REM sleep; GO:0046879 hormone secretion; GO:0046887 positive regulation of hormone secretion; GO:0060124 positive regulation of growth hormone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0043195 terminal bouton; GO:0043204 perikaryon; GO:0043679 axon terminus

Sequence Information

  • Sequence:  HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS
  • Length:  42
  • Propeptide:  MLLWVLFVILILTSGSHCSLPPSPPFRMQRHVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLSRQEDSMWTEDKQMTLESILQGFPRMKPSADA
  • Signal peptide:  MLLWVLFVILILTSGSHCS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Acts on the adenohypophyse to stimulate the secretion of growth hormone
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Ghrhr
  • Target Unid:  P32082
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P16043-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor001980_AF2.pdbhor001980_ESM.pdb

Physical Information

Mass: 576431 Formula: C220H365N69O64S
Absent amino acids: CPW Common amino acids: QR
pI: 10.7 Basic residues: 9
Polar residues: 9 Hydrophobic residues: 14
Hydrophobicity: -71.9 Boman Index: -12103
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 95.24
Instability Index: 2799.76 Extinction Coefficient cystines: 2980
Absorbance 280nm: 72.68

Literature

  • PubMed ID:  1917312
  • Title:  Synthesis and Biological Evaluation of Mouse Growth Hormone-Releasing Factor